PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT13975
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 256aa    MW: 27538.7 Da    PI: 5.6906
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT13975genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1355.1e-4251391128
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.......kvka..eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
               lppG+rF Pt+eel+++yL++k++g++ ++e+vi+ vd+y+v+P +L +          +  e + w++F+ r++++a+g r++r+t sgyWka g+   v
  EMT13975   5 LPPGYRFYPTEEELICFYLRNKLDGSRGDIERVIPVVDVYSVDPLQLSEiherlcgG--GggEGEPWFYFCARQEREARGGRPSRTTPSGYWKAAGTPGVV 103
               79****************************99***************8545655432..1436779*********************************** PP

       NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
               +s++++ +gl+kt+vfy+grap+g+kt+W m+eyr+
  EMT13975 104 YSADRRPIGLRKTMVFYRGRAPSGTKTKWKMNEYRA 139
               **********************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.54E-473180IPR003441NAC domain
PROSITE profilePS5100545.8835180IPR003441NAC domain
PfamPF023652.8E-236138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MADGLPPGYR FYPTEEELIC FYLRNKLDGS RGDIERVIPV VDVYSVDPLQ LSEIHERLCG  60
GGGGEGEPWF YFCARQEREA RGGRPSRTTP SGYWKAAGTP GVVYSADRRP IGLRKTMVFY  120
RGRAPSGTKT KWKMNEYRAF QHEHDGAGAP TATGGPHAAA PPNLPPQLRS EFSLCRLYTK  180
SGTLRQFDRR PVAAAAGGAA GDIPGPSTAA TASPDDGDGS GGSMHPLEED LMEGAGGDPY  240
GDDIATLAAL LYWPTD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-28418616171NO APICAL MERISTEM PROTEIN
1ut4_B2e-28418616171NO APICAL MERISTEM PROTEIN
1ut7_A2e-28418616171NO APICAL MERISTEM PROTEIN
1ut7_B2e-28418616171NO APICAL MERISTEM PROTEIN
3swm_A2e-28418619174NAC domain-containing protein 19
3swm_B2e-28418619174NAC domain-containing protein 19
3swm_C2e-28418619174NAC domain-containing protein 19
3swm_D2e-28418619174NAC domain-containing protein 19
3swp_A2e-28418619174NAC domain-containing protein 19
3swp_B2e-28418619174NAC domain-containing protein 19
3swp_C2e-28418619174NAC domain-containing protein 19
3swp_D2e-28418619174NAC domain-containing protein 19
4dul_A2e-28418616171NAC domain-containing protein 19
4dul_B2e-28418616171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0712741e-158AK071274.1 Oryza sativa Japonica Group cDNA clone:J023087C18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567294.11e-125PREDICTED: NAC domain-containing protein 90-like
SwissprotQ9FMR32e-65NAC90_ARATH; NAC domain-containing protein 90
TrEMBLR7W7490.0R7W749_AEGTA; NAC domain-containing protein 90
STRINGBRADI2G55780.11e-125(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP100538140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.11e-63NAC domain containing protein 90